![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
![]() | Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins) C-terminal domain is alpha+beta is common for the family |
![]() | Protein Phenol hydroxylase [51922] (1 species) structurally very similar to PHBH, but contains additional C-terminal domain of the thioredoxin-like fold |
![]() | Species Soil-living yeast (Trichosporon cutaneum) [TaxId:5554] [51923] (2 PDB entries) |
![]() | Domain d1fohc5: 1foh C:1-240,C:342-461 [30383] Other proteins in same PDB: d1foha3, d1foha4, d1fohb3, d1fohb4, d1fohc3, d1fohc4, d1fohd3, d1fohd4 complexed with fad, iph |
PDB Entry: 1foh (more details), 2.4 Å
SCOPe Domain Sequences for d1fohc5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fohc5 c.3.1.2 (C:1-240,C:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} tkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcrt leslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgri erhildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsdhestplqfg hktenslfhsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfemi Xvtekfskdervfiagdachthspkagqgmntsmmdtynlgwklglvltgrakrdilkty eeerhafaqalidfdhqfsrlfsgrpakdvademgvsmdvfkeafvkgnefasgtainyd e
Timeline for d1fohc5: