![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins) C-terminal part of Pfam PF08715 |
![]() | Protein Papain-like protease PLpro, catalytic domain [310795] (3 species) |
![]() | Species SARS coronavirus [TaxId:227859] [311054] (1 PDB entry) |
![]() | Domain d2fe8c2: 2fe8 C:63-313 [303820] Other proteins in same PDB: d2fe8a1, d2fe8b1, d2fe8c1 complexed with br, so4, zn |
PDB Entry: 2fe8 (more details), 1.85 Å
SCOPe Domain Sequences for d2fe8c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fe8c2 d.3.1.23 (C:63-313) Papain-like protease PLpro, catalytic domain {SARS coronavirus [TaxId: 227859]} dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt dvfyketsytt
Timeline for d2fe8c2:
![]() Domains from other chains: (mouse over for more information) d2fe8a1, d2fe8a2, d2fe8b1, d2fe8b2 |