Lineage for d2fe8c2 (2fe8 C:63-313)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2173267Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2173268Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2174136Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
    C-terminal part of Pfam PF08715
  6. 2174137Protein Papain-like protease PLpro, catalytic domain [310795] (3 species)
  7. 2174152Species SARS coronavirus [TaxId:227859] [311054] (1 PDB entry)
  8. 2174155Domain d2fe8c2: 2fe8 C:63-313 [303820]
    Other proteins in same PDB: d2fe8a1, d2fe8b1, d2fe8c1
    complexed with br, so4, zn

Details for d2fe8c2

PDB Entry: 2fe8 (more details), 1.85 Å

PDB Description: sars coronavirus papain-like protease: structure of a viral deubiquitinating enzyme
PDB Compounds: (C:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d2fe8c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fe8c2 d.3.1.23 (C:63-313) Papain-like protease PLpro, catalytic domain {SARS coronavirus [TaxId: 227859]}
dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq
qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa
krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf
vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt
dvfyketsytt

SCOPe Domain Coordinates for d2fe8c2:

Click to download the PDB-style file with coordinates for d2fe8c2.
(The format of our PDB-style files is described here.)

Timeline for d2fe8c2: