Lineage for d2fe8a2 (2fe8 A:63-315)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927545Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
    C-terminal part of Pfam PF08715
  6. 2927546Protein Papain-like protease PLpro, catalytic domain [310795] (4 species)
  7. 2927561Species SARS coronavirus [TaxId:227859] [311054] (1 PDB entry)
  8. 2927562Domain d2fe8a2: 2fe8 A:63-315 [303816]
    Other proteins in same PDB: d2fe8a1, d2fe8b1, d2fe8c1
    complexed with br, so4, zn

Details for d2fe8a2

PDB Entry: 2fe8 (more details), 1.85 Å

PDB Description: sars coronavirus papain-like protease: structure of a viral deubiquitinating enzyme
PDB Compounds: (A:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d2fe8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fe8a2 d.3.1.23 (A:63-315) Papain-like protease PLpro, catalytic domain {SARS coronavirus [TaxId: 227859]}
dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq
qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa
krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf
vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt
dvfyketsyttti

SCOPe Domain Coordinates for d2fe8a2:

Click to download the PDB-style file with coordinates for d2fe8a2.
(The format of our PDB-style files is described here.)

Timeline for d2fe8a2: