![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.9: Viral protease ubiquitin-like domain [310647] (1 protein) N-terminal part of Pfam PF08715 |
![]() | Protein Papain-like protease PLpro, ubiquitin-like domain [310794] (2 species) |
![]() | Species SARS coronavirus [TaxId:227859] [311052] (1 PDB entry) |
![]() | Domain d2fe8a1: 2fe8 A:1-62 [303815] Other proteins in same PDB: d2fe8a2, d2fe8b2, d2fe8c2 complexed with br, so4, zn |
PDB Entry: 2fe8 (more details), 1.85 Å
SCOPe Domain Sequences for d2fe8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fe8a1 d.15.1.9 (A:1-62) Papain-like protease PLpro, ubiquitin-like domain {SARS coronavirus [TaxId: 227859]} mevktikvfttvdntnlhtqlvdmsmtygqqfgptyldgadvtkikphvnhegktffvlp sd
Timeline for d2fe8a1:
![]() Domains from other chains: (mouse over for more information) d2fe8b1, d2fe8b2, d2fe8c1, d2fe8c2 |