![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.91: PEP carboxykinase-like [53794] (1 superfamily) contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side |
![]() | Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) ![]() |
![]() | Family c.91.1.0: automated matches [196141] (1 protein) not a true family |
![]() | Protein automated matches [196142] (6 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [225084] (4 PDB entries) |
![]() | Domain d2fagb2: 2fag B:279-641 [303813] Other proteins in same PDB: d2faga1, d2fagb1 automated match to d2zcia2 complexed with 20s, epe, mn, pep |
PDB Entry: 2fag (more details), 1.9 Å
SCOPe Domain Sequences for d2fagb2:
Sequence, based on SEQRES records: (download)
>d2fagb2 c.91.1.0 (B:279-641) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} wlaehmlilgvtspsgekrymaaafpsacgktnlammtpslpgwrihcvgddiawmkfdd egrlrainpergffgvapgtssrtnpnamatiarntiftnvglrsdggvywdgldeptep gvtytswlgkpwkhgdpepcahpnsrfcapadqcpimdprwddpegvpidaiifggrrpr gvplvveafgwrhgvfmgsamrseataaaehkggrlmhdpfamrpffgynagrylehwls tglrsnarlprlfhvnwflrdnegrfvwpgfghnarvlawifgriqgrdtarptpigwvp kegdldlgglpgvdysqlfpmekgfweeecrqlreyygenfgadlprdvmaelegleerv rkm
>d2fagb2 c.91.1.0 (B:279-641) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} wlaehmlilgvtspsgekrymaaafpsacgktnlammtpslpgwrihcvgddiawmkfdd egrlrainpergffgvapgtssrtnpnamatiarntiftnvglrsdggvywdgldeptep gvtytswlgkpwkhgdpepcahpnsrfcapadqcpimdprwddpegvpidaiifggrrpr gvplvveafgwrhgvfmgsamrselmhdpfamrpffgynagrylehwlstglrsnarlpr lfhvnwflrdnegrfvwpgfghnarvlawifgriqgrdtarptpigwvpkegdldlgglp gvdysqlfpmekgfweeecrqlreyygenfgadlprdvmaelegleervrkm
Timeline for d2fagb2: