Lineage for d2fagb2 (2fag B:279-641)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143071Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2143072Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2143188Family c.91.1.0: automated matches [196141] (1 protein)
    not a true family
  6. 2143189Protein automated matches [196142] (6 species)
    not a true protein
  7. 2143195Species Chicken (Gallus gallus) [TaxId:9031] [225084] (4 PDB entries)
  8. 2143199Domain d2fagb2: 2fag B:279-641 [303813]
    Other proteins in same PDB: d2faga1, d2fagb1
    automated match to d2zcia2
    complexed with 20s, epe, mn, pep

Details for d2fagb2

PDB Entry: 2fag (more details), 1.9 Å

PDB Description: The structure of chicken mitochondrial PEPCK.
PDB Compounds: (B:) phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d2fagb2:

Sequence, based on SEQRES records: (download)

>d2fagb2 c.91.1.0 (B:279-641) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
wlaehmlilgvtspsgekrymaaafpsacgktnlammtpslpgwrihcvgddiawmkfdd
egrlrainpergffgvapgtssrtnpnamatiarntiftnvglrsdggvywdgldeptep
gvtytswlgkpwkhgdpepcahpnsrfcapadqcpimdprwddpegvpidaiifggrrpr
gvplvveafgwrhgvfmgsamrseataaaehkggrlmhdpfamrpffgynagrylehwls
tglrsnarlprlfhvnwflrdnegrfvwpgfghnarvlawifgriqgrdtarptpigwvp
kegdldlgglpgvdysqlfpmekgfweeecrqlreyygenfgadlprdvmaelegleerv
rkm

Sequence, based on observed residues (ATOM records): (download)

>d2fagb2 c.91.1.0 (B:279-641) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
wlaehmlilgvtspsgekrymaaafpsacgktnlammtpslpgwrihcvgddiawmkfdd
egrlrainpergffgvapgtssrtnpnamatiarntiftnvglrsdggvywdgldeptep
gvtytswlgkpwkhgdpepcahpnsrfcapadqcpimdprwddpegvpidaiifggrrpr
gvplvveafgwrhgvfmgsamrselmhdpfamrpffgynagrylehwlstglrsnarlpr
lfhvnwflrdnegrfvwpgfghnarvlawifgriqgrdtarptpigwvpkegdldlgglp
gvdysqlfpmekgfweeecrqlreyygenfgadlprdvmaelegleervrkm

SCOPe Domain Coordinates for d2fagb2:

Click to download the PDB-style file with coordinates for d2fagb2.
(The format of our PDB-style files is described here.)

Timeline for d2fagb2:

  • d2fagb2 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d2fagb1