Lineage for d2faga1 (2fag A:34-278)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920699Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2920700Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2920813Family c.109.1.0: automated matches [227144] (1 protein)
    not a true family
  6. 2920814Protein automated matches [226847] (5 species)
    not a true protein
  7. 2920820Species Chicken (Gallus gallus) [TaxId:9031] [225083] (4 PDB entries)
  8. 2920821Domain d2faga1: 2fag A:34-278 [303810]
    Other proteins in same PDB: d2faga2, d2fagb2
    automated match to d2zcid1
    complexed with 20s, epe, mn, pep

Details for d2faga1

PDB Entry: 2fag (more details), 1.9 Å

PDB Description: The structure of chicken mitochondrial PEPCK.
PDB Compounds: (A:) phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d2faga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2faga1 c.109.1.0 (A:34-278) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
lstslsalpaaardfveeavrlcrprevllcdgseeegkellrglqddgvlhplpkydnc
wlartdprdvarvesktvlvtpeqsdavpppppsggppqlgnwmspnafqaavqerfpgc
magrplyvipfsmgpptsplaklgvqvtdspyvvlsmrimtrvgpavlqrldddfvrclh
svgrplplteplvsswpcdpsrvlvahipserrivsfgsgyggnsllgkkcfalriasrm
aqqqg

SCOPe Domain Coordinates for d2faga1:

Click to download the PDB-style file with coordinates for d2faga1.
(The format of our PDB-style files is described here.)

Timeline for d2faga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2faga2