Lineage for d2euba_ (2eub A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2438295Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2438296Family c.23.1.1: CheY-related [52173] (26 protein domains)
  6. 2438454Protein PhoP receiver domain [82340] (2 species)
  7. 2438457Species Escherichia coli [TaxId:562] [159479] (4 PDB entries)
    Uniprot P23836 1-119
  8. 2438458Domain d2euba_: 2eub A: [303799]
    automated match to d2pkxa1
    complexed with bef, mg, pt

Details for d2euba_

PDB Entry: 2eub (more details), 1.85 Å

PDB Description: E.coli PhoP receiver domain activated with BeF3-
PDB Compounds: (A:) Transcriptional regulatory protein phoP

SCOPe Domain Sequences for d2euba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2euba_ c.23.1.1 (A:) PhoP receiver domain {Escherichia coli [TaxId: 562]}
mrvlvvednallrhhlkvqiqdaghqvddaedakeadyylnehipdiaivdlglpdedgl
slirrwrsndvslpilvltareswqdkvevlsagaddyvtkpfhieevmarmqalmrrns
q

SCOPe Domain Coordinates for d2euba_:

Click to download the PDB-style file with coordinates for d2euba_.
(The format of our PDB-style files is described here.)

Timeline for d2euba_: