![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily) 3 helices; bundle, closed, right-handed twist; up-and-down |
![]() | Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) ![]() |
![]() | Family a.9.1.0: automated matches [191674] (1 protein) not a true family |
![]() | Protein automated matches [191291] (5 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:300852] [311204] (1 PDB entry) |
![]() | Domain d2eq9i_: 2eq9 I: [303791] automated match to d1w4ka_ complexed with fad |
PDB Entry: 2eq9 (more details), 2.09 Å
SCOPe Domain Sequences for d2eq9i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eq9i_ a.9.1.0 (I:) automated matches {Thermus thermophilus [TaxId: 300852]} mlavpaarklarelgipieevpgsgplgrvrvedvrayae
Timeline for d2eq9i_: