SCOPe 2.07: Domain d2eq9i_: 2eq9 I:

Lineage for d2eq9i_ (2eq9 I:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
   3 helices; bundle, closed, right-handed twist; up-and-down

4. Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families)

5. Family a.9.1.0: automated matches [191674] (1 protein)
   not a true family

6. Protein automated matches [191291] (5 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [311204] (1 PDB entry)

8. Domain d2eq9i_: 2eq9 I: [303791]
   automated match to d1w4ka_
   complexed with fad

Details for d2eq9i_

PDB Entry: 2eq9, 2.09 Å

PDB Description: Crystal structure of lipoamide dehydrogenase from thermus thermophilus HB8 with psbdb

PDB Compounds: (I:) Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component

SCOPe Domain Sequences for d2eq9i_:

Sequence; same for both SEQRES and ATOM records:

>d2eq9i_ a.9.1.0 (I:) automated matches {Thermus thermophilus [TaxId: 300852]}
mlavpaarklarelgipieevpgsgplgrvrvedvrayae

Timeline for d2eq9i_:

• d2eq9i_ first appeared in SCOPe 2.06