Lineage for d2eq9i_ (2eq9 I:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697346Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
    3 helices; bundle, closed, right-handed twist; up-and-down
  4. 2697347Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) (S)
  5. 2697377Family a.9.1.0: automated matches [191674] (1 protein)
    not a true family
  6. 2697378Protein automated matches [191291] (5 species)
    not a true protein
  7. 2697396Species Thermus thermophilus [TaxId:300852] [311204] (1 PDB entry)
  8. 2697399Domain d2eq9i_: 2eq9 I: [303791]
    automated match to d1w4ka_
    complexed with fad

Details for d2eq9i_

PDB Entry: 2eq9 (more details), 2.09 Å

PDB Description: Crystal structure of lipoamide dehydrogenase from thermus thermophilus HB8 with psbdb
PDB Compounds: (I:) Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component

SCOPe Domain Sequences for d2eq9i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eq9i_ a.9.1.0 (I:) automated matches {Thermus thermophilus [TaxId: 300852]}
mlavpaarklarelgipieevpgsgplgrvrvedvrayae

SCOPe Domain Coordinates for d2eq9i_:

Click to download the PDB-style file with coordinates for d2eq9i_.
(The format of our PDB-style files is described here.)

Timeline for d2eq9i_: