![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
![]() | Protein automated matches [190526] (26 species) not a true protein |
![]() | Species Fungia concinna [TaxId:496660] [193728] (8 PDB entries) |
![]() | Domain d2ejpd_: 2ejp D: [303788] automated match to d2zmua_ |
PDB Entry: 2ejp (more details), 2 Å
SCOPe Domain Sequences for d2ejpd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ejpd_ d.22.1.0 (D:) automated matches {Fungia concinna [TaxId: 496660]} vsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlvs hvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhks kftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfkttyk aakkilkmpgshyishrlvrktegnitelvedavahs
Timeline for d2ejpd_: