Lineage for d2ejpd_ (2ejp D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2940994Species Fungia concinna [TaxId:496660] [193728] (8 PDB entries)
  8. 2941004Domain d2ejpd_: 2ejp D: [303788]
    automated match to d2zmua_

Details for d2ejpd_

PDB Entry: 2ejp (more details), 2 Å

PDB Description: Crystal structure of monomeric kusabira-orange (mKO), orange-emitting GFP-like protein, at pH 6.0
PDB Compounds: (D:) fluorescent protein

SCOPe Domain Sequences for d2ejpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ejpd_ d.22.1.0 (D:) automated matches {Fungia concinna [TaxId: 496660]}
vsvikpemkmryymdgsvngheftiegegtgrpyeghqemtlrvtmakggpmpfafdlvs
hvfcyghrpftkypeeipdyfkqafpeglswerslefedggsasvsahislrgntfyhks
kftgvnfpadgpimqnqsvdwepstekitasdgvlkgdvtmylklegggnhkcqfkttyk
aakkilkmpgshyishrlvrktegnitelvedavahs

SCOPe Domain Coordinates for d2ejpd_:

Click to download the PDB-style file with coordinates for d2ejpd_.
(The format of our PDB-style files is described here.)

Timeline for d2ejpd_: