Lineage for d2ehmb4 (2ehm B:149-286)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385272Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2385273Family b.42.2.1: Ricin B-like [50371] (11 protein domains)
  6. 2385440Protein automated matches [190608] (4 species)
    not a true protein
  7. 2385441Species Clostridium botulinum [TaxId:1491] [230685] (7 PDB entries)
  8. 2385453Domain d2ehmb4: 2ehm B:149-286 [303777]
    automated match to d2e4ma2
    complexed with nga

Details for d2ehmb4

PDB Entry: 2ehm (more details), 1.7 Å

PDB Description: HA1 subcomponent of botulinum type C progenitor toxin complexed with N-acetylgalactosamine
PDB Compounds: (B:) Main hemagglutinin component

SCOPe Domain Sequences for d2ehmb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ehmb4 b.42.2.1 (B:149-286) automated matches {Clostridium botulinum [TaxId: 1491]}
nrncklqtqlnsdrflsknlnsqiivlwqwfdssrqkwiieynetksaytlkcqennryl
twiqnsnnyvetyqstdsliqywninyldndaskyilynlqdtnrvldvynsqiangthv
ivdsyhgntnqqwiinli

SCOPe Domain Coordinates for d2ehmb4:

Click to download the PDB-style file with coordinates for d2ehmb4.
(The format of our PDB-style files is described here.)

Timeline for d2ehmb4:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ehmb3