Lineage for d2ehkb_ (2ehk B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489766Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2490017Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 2490018Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins)
    Pfam PF01725
  6. 2490033Protein XTP pyrophosphatase [52974] (2 species)
  7. 2490039Species Pyrococcus horikoshii [TaxId:53953] [102470] (7 PDB entries)
    PH1917
  8. 2490048Domain d2ehkb_: 2ehk B: [303773]
    automated match to d1v7ra_
    complexed with mn

Details for d2ehkb_

PDB Entry: 2ehk (more details), 2.6 Å

PDB Description: Structure of PH1917 from Pyrococcus horikoshii
PDB Compounds: (B:) ntpase

SCOPe Domain Sequences for d2ehkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ehkb_ c.51.4.1 (B:) XTP pyrophosphatase {Pyrococcus horikoshii [TaxId: 53953]}
mkiffitsnpgkvrevanflgtfgieivqlkheypeiqaekledvvdfgiswlkgkvpep
fmiedsglfieslkgfpgvyssyvyrtiglegilklmegaedrrayfksvigfyidgkay
kfsgvtwgrisnekrgthgfgydpifipegsektfaemtieeknalshrgkalkaffewl
kvnl

SCOPe Domain Coordinates for d2ehkb_:

Click to download the PDB-style file with coordinates for d2ehkb_.
(The format of our PDB-style files is described here.)

Timeline for d2ehkb_: