SCOPe 2.08: Domain d2ehkb_: 2ehk B:

Lineage for d2ehkb_ (2ehk B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins)
   Pfam PF01725

6. Protein XTP pyrophosphatase [52974] (2 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [102470] (7 PDB entries)
   PH1917

8. Domain d2ehkb_: 2ehk B: [303773]
   automated match to d1v7ra_
   complexed with mn

Details for d2ehkb_

PDB Entry: 2ehk, 2.6 Å

PDB Description: Structure of PH1917 from Pyrococcus horikoshii

PDB Compounds: (B:) ntpase

SCOPe Domain Sequences for d2ehkb_:

Sequence; same for both SEQRES and ATOM records:

>d2ehkb_ c.51.4.1 (B:) XTP pyrophosphatase {Pyrococcus horikoshii [TaxId: 53953]}
mkiffitsnpgkvrevanflgtfgieivqlkheypeiqaekledvvdfgiswlkgkvpep
fmiedsglfieslkgfpgvyssyvyrtiglegilklmegaedrrayfksvigfyidgkay
kfsgvtwgrisnekrgthgfgydpifipegsektfaemtieeknalshrgkalkaffewl
kvnl

Timeline for d2ehkb_:

• d2ehkb_ first appeared in SCOPe 2.06
  
• d2ehkb_ appears in SCOPe 2.07