Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.4: ITPase-like [52972] (4 families) formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins) Pfam PF01725 |
Protein XTP pyrophosphatase [52974] (2 species) |
Species Pyrococcus horikoshii [TaxId:53953] [102470] (7 PDB entries) PH1917 |
Domain d2ehka_: 2ehk A: [303772] automated match to d1v7ra_ complexed with mn |
PDB Entry: 2ehk (more details), 2.6 Å
SCOPe Domain Sequences for d2ehka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ehka_ c.51.4.1 (A:) XTP pyrophosphatase {Pyrococcus horikoshii [TaxId: 53953]} mkiffitsnpgkvrevanflgtfgieivqlkheypeiqaekledvvdfgiswlkgkvpep fmiedsglfieslkgfpgvyssyvyrtiglegilklmegaedrrayfksvigfyidgkay kfsgvtwgrisnekrgthgfgydpifipegsektfaemtieeknalshrgkalkaffewl kvnl
Timeline for d2ehka_: