Lineage for d2eg0b_ (2eg0 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079733Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2079734Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2079927Family b.81.1.5: gamma-carbonic anhydrase-like [51174] (4 proteins)
    archaeal hexapeptide repeat proteins
    this is a repeat family; one repeat unit is 1v3w A:71-88 found in domain
  6. 2079952Protein automated matches [190628] (1 species)
    not a true protein
  7. 2079953Species Geobacillus kaustophilus [TaxId:1462] [187665] (2 PDB entries)
  8. 2079958Domain d2eg0b_: 2eg0 B: [303765]
    automated match to d3vnpa_
    complexed with mg

Details for d2eg0b_

PDB Entry: 2eg0 (more details), 2.42 Å

PDB Description: Crystal Structure of Hypothetical Protein(GK2848) from Geobacillus kaustophilus
PDB Compounds: (B:) Hypothetical conserved protein

SCOPe Domain Sequences for d2eg0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eg0b_ b.81.1.5 (B:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
miypykgktpqiaasafiadyvtitgdvvigeetsiwfntvirgdvaptvignrvniqdn
silhqspnnpliiedgvtvghqvilhsaivrknaligmgsiildraeigegafigagslv
ppgkkippntlalgrpakvvrelteddiremerirreyvekgqyykalqqq

SCOPe Domain Coordinates for d2eg0b_:

Click to download the PDB-style file with coordinates for d2eg0b_.
(The format of our PDB-style files is described here.)

Timeline for d2eg0b_: