![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (26 proteins) |
![]() | Protein Cruzain [54020] (1 species) |
![]() | Species Trypanosoma cruzi [TaxId:5693] [54021] (29 PDB entries) |
![]() | Domain d2efmc_: 2efm C: [303763] automated match to d1me4a_ complexed with 4mc, edo, so4 |
PDB Entry: 2efm (more details), 1.5 Å
SCOPe Domain Sequences for d2efmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2efmc_ d.3.1.1 (C:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii knswttqwgeegyiriakgsnqclvkeeassavvg
Timeline for d2efmc_: