SCOPe 2.08: Domain d2efmc_: 2efm C:

Lineage for d2efmc_ (2efm C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Cruzain [54020] (1 species)

7. Species Trypanosoma cruzi [TaxId:5693] [54021] (29 PDB entries)

8. Domain d2efmc_: 2efm C: [303763]
   automated match to d1me4a_
   complexed with 4mc, edo, so4

Details for d2efmc_

PDB Entry: 2efm, 1.5 Å

PDB Description: crystal structure analysis of cruzain bound to vinyl sulfone derived inhibitor (WR483)

PDB Compounds: (C:) Cruzipain

SCOPe Domain Sequences for d2efmc_:

Sequence; same for both SEQRES and ATOM records:

>d2efmc_ d.3.1.1 (C:) Cruzain {Trypanosoma cruzi [TaxId: 5693]}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
knswttqwgeegyiriakgsnqclvkeeassavvg

Timeline for d2efmc_:

• d2efmc_ first appeared in SCOPe 2.06
  
• d2efmc_ appears in SCOPe 2.07