Lineage for d1elib1 (1eli B:1-217,B:322-385)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 388822Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 388823Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 388877Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (13 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 389046Protein Sarcosine oxidase [51920] (1 species)
  7. 389047Species Bacillus sp., strain b0618 [TaxId:1409] [51921] (9 PDB entries)
  8. 389063Domain d1elib1: 1eli B:1-217,B:322-385 [30376]
    Other proteins in same PDB: d1elia2, d1elib2
    complexed with cl, fad, po4, pyc

Details for d1elib1

PDB Entry: 1eli (more details), 2 Å

PDB Description: complex of monomeric sarcosine oxidase with the inhibitor pyrrole-2- carboxylate

SCOP Domain Sequences for d1elib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1elib1 c.3.1.2 (B:1-217,B:322-385) Sarcosine oxidase {Bacillus sp., strain b0618}
sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
dsvkietangsytadklivsmgawnskllsklnldipXdehfiidlhpehsnvviaagfs
ghgfkfssgvgevlsqlaltgktehdisifsinrpalkeslq

SCOP Domain Coordinates for d1elib1:

Click to download the PDB-style file with coordinates for d1elib1.
(The format of our PDB-style files is described here.)

Timeline for d1elib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1elib2