SCOPe 2.08: Domain d2e61a1: 2e61 A:8-69

Lineage for d2e61a1 (2e61 A:8-69)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.2: CW-type zinc finger [310596] (1 family)
   Pfam PF07496
   Binds only one zinc; similarity and possible homology to PHD domains noted in PubMed 20826339

5. Family g.50.2.1: CW-type zinc finger [310644] (2 proteins)

6. Protein zf-CW and PWWP domain containing protein 1 (ZCWPW1) [310787] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [311044] (2 PDB entries)

8. Domain d2e61a1: 2e61 A:8-69 [303757]
   Other proteins in same PDB: d2e61a2
   complexed with zn

Details for d2e61a1

PDB Entry: 2e61

PDB Description: Solution structure of the zf-CW domain in zinc finger CW-type PWWP domain protein 1

PDB Compounds: (A:) Zinc finger CW-type PWWP domain protein 1

SCOPe Domain Sequences for d2e61a1:

Sequence; same for both SEQRES and ATOM records:

>d2e61a1 g.50.2.1 (A:8-69) zf-CW and PWWP domain containing protein 1 (ZCWPW1) {Human (Homo sapiens) [TaxId: 9606]}
eisgfgqclvwvqcsfpncgkwrrlcgnidpsvlpdnwscdqntdvqynrcdipeetwtg
le

Timeline for d2e61a1:

• d2e61a1 first appeared in SCOPe 2.06
  
• d2e61a1 appears in SCOPe 2.07