SCOPe 2.07: Domain d2e3ya1: 2e3y A:1-188

Lineage for d2e3ya1 (2e3y A:1-188)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins)

6. Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143641] (27 PDB entries)
   Uniprot O57883 1-188

8. Domain d2e3ya1: 2e3y A:1-188 [303753]
   Other proteins in same PDB: d2e3ya2, d2e3yb2
   automated match to d2zgwa2
   complexed with adn, btn; mutant

Details for d2e3ya1

PDB Entry: 2e3y, 1.5 Å

PDB Description: Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii Complexed with Adenosine and Biotin, Mutations R48A and K111A

PDB Compounds: (A:) biotin--[acetyl-CoA-carboxylase] ligase

SCOPe Domain Sequences for d2e3ya1:

Sequence; same for both SEQRES and ATOM records:

>d2e3ya1 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgalnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykaiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

Timeline for d2e3ya1:

• d2e3ya1 first appeared in SCOPe 2.06
  
• d2e3ya1 appears in the current release, SCOPe 2.08