Lineage for d2e1tb2 (2e1t B:242-450)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115786Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2115787Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2115955Family c.43.1.4: benzylalcohol acetyl-, anthocyanin-O-hydroxy-cinnamoyl-, anthranilate-N-hydroxy-cinnamoyl/benzoyl-, deacetylvindoline acetyltransferase (BAHD) family [310660] (2 protein domains)
    Pfam PF02458
  6. 2115956Protein Anthocyanin acyltransferase [310826] (1 species)
  7. 2115957Species Chrysanthemum x morifolium [TaxId:41568] [311095] (2 PDB entries)
  8. 2115965Domain d2e1tb2: 2e1t B:242-450 [303748]
    complexed with mlc

Details for d2e1tb2

PDB Entry: 2e1t (more details), 2.1 Å

PDB Description: Crystal structure of Dendranthema morifolium DmAT complexed with malonyl-CoA
PDB Compounds: (B:) acyl transferase

SCOPe Domain Sequences for d2e1tb2:

Sequence, based on SEQRES records: (download)

>d2e1tb2 c.43.1.4 (B:242-450) Anthocyanin acyltransferase {Chrysanthemum x morifolium [TaxId: 41568]}
sdklratfiltravinqlkdrvlaqlptleyvssftvacayiwsciaksrndklqlfgfp
idrrarmkppiptayfgncvggcaaiaktnlligkegfitaakligenlhktltdykdgv
lkddmesfndlvsegmpttmtwvsgtpklrfydmdfgwgkpkkletvsidhngaisinsc
kesnedleigvcisatqmedfvhifddgl

Sequence, based on observed residues (ATOM records): (download)

>d2e1tb2 c.43.1.4 (B:242-450) Anthocyanin acyltransferase {Chrysanthemum x morifolium [TaxId: 41568]}
sdklratfiltravinqlkdrvlaqlptleyvssftvacayiwsciaksrndklqlfgfp
idrrarmkppiptayfgncvggcaaiaktnlligkegfitaakligenlhktltdykdgv
lkdndlvsegmpttmtwvsgtpklrfydmdfgwgkpkkletvsidhngaisinsckesne
dleigvcisatqmedfvhifddgl

SCOPe Domain Coordinates for d2e1tb2:

Click to download the PDB-style file with coordinates for d2e1tb2.
(The format of our PDB-style files is described here.)

Timeline for d2e1tb2:

  • d2e1tb2 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d2e1tb1