Lineage for d2dv8a_ (2dv8 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346280Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (39 PDB entries)
    Uniprot P59071
  8. 2346292Domain d2dv8a_: 2dv8 A: [303743]
    automated match to d1tk4a_
    complexed with imn, so4

Details for d2dv8a_

PDB Entry: 2dv8 (more details), 1.4 Å

PDB Description: Crystal structure of Phospholipase A2 complex with Indomethacin at 1.4 A resolution reveals a novel non-competitive ligand binding site
PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d2dv8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dv8a_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d2dv8a_:

Click to download the PDB-style file with coordinates for d2dv8a_.
(The format of our PDB-style files is described here.)

Timeline for d2dv8a_: