Lineage for d2diwa1 (2diw A:8-146)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2334132Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2334209Family a.118.9.4: RNA Polymerase II carboxy-terminal domain (CTD)-interacting (CID) domain (RPR domain) [109975] (4 proteins)
    found in proteins involved in regulation of nuclear pre-mRNA; some sequence similarity to VHS domain
    SMART 00582; Pfam PF04818
  6. 2334226Protein SCAF8; RNA-binding protein 16 [310741] (1 species)
  7. 2334227Species Human (Homo sapiens) [TaxId:9606] [310994] (4 PDB entries)
  8. 2334234Domain d2diwa1: 2diw A:8-146 [303733]
    Other proteins in same PDB: d2diwa2, d2diwa3

Details for d2diwa1

PDB Entry: 2diw (more details)

PDB Description: Solution structure of the RPR domain of Putative RNA-binding protein 16
PDB Compounds: (A:) Putative RNA-binding protein 16

SCOPe Domain Sequences for d2diwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2diwa1 a.118.9.4 (A:8-146) SCAF8; RNA-binding protein 16 {Human (Homo sapiens) [TaxId: 9606]}
dnmeavktfnselyslndykppiskakmtqitkaaikaikfykhvvqsvekfiqkckpey
kvpglyvidsivrqsrhqfgqekdvfaprfsnniistfqnlyrcpgddkskivrvlnlwq
knnvfkseiiqplldmaag

SCOPe Domain Coordinates for d2diwa1:

Click to download the PDB-style file with coordinates for d2diwa1.
(The format of our PDB-style files is described here.)

Timeline for d2diwa1: