Lineage for d2dfza_ (2dfz A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2164321Species Thermoactinomyces vulgaris [TaxId:2026] [193732] (5 PDB entries)
  8. 2164325Domain d2dfza_: 2dfz A: [303724]
    automated match to d2zyma_

Details for d2dfza_

PDB Entry: 2dfz (more details), 2.5 Å

PDB Description: Crystal structure of cyclodextrin-binding protein complexed with gamma-cyclodextrin
PDB Compounds: (A:) periplasmic binding protein

SCOPe Domain Sequences for d2dfza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dfza_ c.94.1.0 (A:) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
kpdklvvwenaddgvqlnntkkwageftkktgiqvevvpvallkqqekltldgpagkgad
lvtwphdrlgeavtkgllqpiqvdnsvknqfddvamkaltyggklyglpkaiesvaliyn
kklmgqvpatydelfqyakannkpdeqkygvlfeannfyytyflfaakgaavfkeqdgtl
dpneiglnspeavqgmnevqkwftearlpqslkadtvnglfksgkvaavingpwaikdyq
aaginvgvaplpkidgkdaqtfigvkgwylsayskypkyatelmqfltskealasrfket
geippqkellndpmiknnpvvngfakqaskgvpmpsipemgvvwepinnahtfvaqgkqt
peqalndavkimkekiqtmkq

SCOPe Domain Coordinates for d2dfza_:

Click to download the PDB-style file with coordinates for d2dfza_.
(The format of our PDB-style files is described here.)

Timeline for d2dfza_: