Lineage for d2d2ya_ (2d2y A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738379Fold a.255: Rv1873-like [140735] (1 superfamily)
    multihelical; contains unusually short buried central helix
  4. 2738380Superfamily a.255.1: Rv1873-like [140736] (1 family) (S)
    automatically mapped to Pfam PF08837
  5. 2738381Family a.255.1.1: Rv1873-like [140737] (1 protein)
    contains conserved motif HWuW at the beginning of the central helix
  6. 2738382Protein Hypothetical protein Rv1873 (MT1922) [140738] (1 species)
  7. 2738383Species Mycobacterium tuberculosis [TaxId:1773] [140739] (2 PDB entries)
    Uniprot O07756 6-145
  8. 2738384Domain d2d2ya_: 2d2y A: [303703]
    automated match to d2jeka1
    complexed with gol, so4

Details for d2d2ya_

PDB Entry: 2d2y (more details), 1.58 Å

PDB Description: Crystal structure of the conserved hypothetical protein Rv1873 from Mycobacterium tuberculosis at 1.58 A
PDB Compounds: (A:) hypothetical protein Rv1873

SCOPe Domain Sequences for d2d2ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d2ya_ a.255.1.1 (A:) Hypothetical protein Rv1873 (MT1922) {Mycobacterium tuberculosis [TaxId: 1773]}
dpfdlkrfvyaqapvyrsvveelragrkrghwmwfvfpqlrglgssplavrygissleea
qaylqhdllgprlhectglvnqvqgrsieeifgppddlklcssmtlfaratdanqdfval
lakyygggedrrtvallavt

SCOPe Domain Coordinates for d2d2ya_:

Click to download the PDB-style file with coordinates for d2d2ya_.
(The format of our PDB-style files is described here.)

Timeline for d2d2ya_: