| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.255: Rv1873-like [140735] (1 superfamily) multihelical; contains unusually short buried central helix |
Superfamily a.255.1: Rv1873-like [140736] (1 family) ![]() automatically mapped to Pfam PF08837 |
| Family a.255.1.1: Rv1873-like [140737] (1 protein) contains conserved motif HWuW at the beginning of the central helix |
| Protein Hypothetical protein Rv1873 (MT1922) [140738] (1 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [140739] (2 PDB entries) Uniprot O07756 6-145 |
| Domain d2d2ya_: 2d2y A: [303703] automated match to d2jeka1 complexed with gol, so4 |
PDB Entry: 2d2y (more details), 1.58 Å
SCOPe Domain Sequences for d2d2ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d2ya_ a.255.1.1 (A:) Hypothetical protein Rv1873 (MT1922) {Mycobacterium tuberculosis [TaxId: 1773]}
dpfdlkrfvyaqapvyrsvveelragrkrghwmwfvfpqlrglgssplavrygissleea
qaylqhdllgprlhectglvnqvqgrsieeifgppddlklcssmtlfaratdanqdfval
lakyygggedrrtvallavt
Timeline for d2d2ya_: