SCOPe 2.06: Domain d2d12a_: 2d12 A:

Lineage for d2d12a_ (2d12 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein 29-kDa galactose-binding lectin [159148] (1 species)
   duplication: tadem repeat of two Ricin B-like domains

7. Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [159149] (5 PDB entries)
   Uniprot O96048 131-260

8. Domain d2d12a_: 2d12 A: [303701]
   automated match to d2zqoa1
   complexed with imd, po4

Details for d2d12a_

PDB Entry: 2d12, 1.9 Å

PDB Description: Crystal structure of the earthworm R-type lectin C-half

PDB Compounds: (A:) 29-kDa galactose-binding lectin

SCOPe Domain Sequences for d2d12a_:

Sequence; same for both SEQRES and ATOM records:

>d2d12a_ b.42.2.1 (A:) 29-kDa galactose-binding lectin {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
pkffyikselngkvldiegqnpapgskiitwdqkkgptavnqlwytdqqgvirsklndfa
idasheqietqpfdpnnpkrawivsgntiaqlsdrdivldiiksdkeagahicawkqhgg
pnqkfiiese

Timeline for d2d12a_:

• d2d12a_ is new in SCOPe 2.06-stable
  
• d2d12a_ appears in SCOPe 2.07
  
• d2d12a_ appears in the current release, SCOPe 2.08