Lineage for d2ct9b1 (2ct9 B:3-195)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2324762Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2324763Protein automated matches [190513] (36 species)
    not a true protein
  7. 2324947Species Norway rat (Rattus norvegicus) [TaxId:10116] [238064] (3 PDB entries)
  8. 2324949Domain d2ct9b1: 2ct9 B:3-195 [303698]
    Other proteins in same PDB: d2ct9a2, d2ct9b2
    automated match to d2e30a_
    complexed with ca

Details for d2ct9b1

PDB Entry: 2ct9 (more details), 2.2 Å

PDB Description: The crystal structure of calcineurin B homologous proein 1 (CHP1)
PDB Compounds: (B:) Calcium-binding protein p22

SCOPe Domain Sequences for d2ct9b1:

Sequence, based on SEQRES records: (download)

>d2ct9b1 a.39.1.0 (B:3-195) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
srastllrdeeleeikketgfshsqitrlysrftsldkgengtlsredfqripelainpl
gdriinaffsegedqvnfrgfmrtlahfrpiednekskdvngpeplnsrsnklhfafrly
dldkddkisrdellqvlrmmvgvnisdeqlgsiadrtiqeadqdgdsaisftefvkvlek
vdveqkmsirflh

Sequence, based on observed residues (ATOM records): (download)

>d2ct9b1 a.39.1.0 (B:3-195) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
srastllrdeeleeikketgfshsqitrlysrftsldkgengtlsredfqripelainpl
gdriinaffsegedqvnfrgfmrtlahfrpiednedvngpeplnsrsnklhfafrlydld
kddkisrdellqvlrmmvgvnisdeqlgsiadrtiqeadqdgdsaisftefvkvlekvdv
eqkmsirflh

SCOPe Domain Coordinates for d2ct9b1:

Click to download the PDB-style file with coordinates for d2ct9b1.
(The format of our PDB-style files is described here.)

Timeline for d2ct9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ct9b2