![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
![]() | Protein automated matches [190513] (36 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [238064] (3 PDB entries) |
![]() | Domain d2ct9a1: 2ct9 A:8-195 [303696] Other proteins in same PDB: d2ct9a2, d2ct9b2 automated match to d2e30a_ complexed with ca |
PDB Entry: 2ct9 (more details), 2.2 Å
SCOPe Domain Sequences for d2ct9a1:
Sequence, based on SEQRES records: (download)
>d2ct9a1 a.39.1.0 (A:8-195) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} llrdeeleeikketgfshsqitrlysrftsldkgengtlsredfqripelainplgdrii naffsegedqvnfrgfmrtlahfrpiednekskdvngpeplnsrsnklhfafrlydldkd dkisrdellqvlrmmvgvnisdeqlgsiadrtiqeadqdgdsaisftefvkvlekvdveq kmsirflh
>d2ct9a1 a.39.1.0 (A:8-195) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} llrdeeleeikketgfshsqitrlysrftsldkgengtlsredfqripelainplgdrii naffsegedqvnfrgfmrtlahfrpieeplnsrsnklhfafrlydldkddkisrdellqv lrmmvgvnisdeqlgsiadrtiqeadqdgdsaisftefvkvlekvdveqkmsirflh
Timeline for d2ct9a1: