![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins) |
![]() | Protein Transcriptional regulator TTHA1359, C-terminal domain [140233] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [140234] (2 PDB entries) Uniprot Q5SIL0 118-199 |
![]() | Domain d2coha4: 2coh A:118-199 [303692] Other proteins in same PDB: d2coha3 automated match to d2zcwa1 complexed with mpd |
PDB Entry: 2coh (more details), 1.5 Å
SCOPe Domain Sequences for d2coha4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2coha4 a.4.5.4 (A:118-199) Transcriptional regulator TTHA1359, C-terminal domain {Thermus thermophilus [TaxId: 274]} rlknrmaaallelsetplaheeegkvvlkathdelaaavgsvretvtkvigelaregyir sgygkiqlldlkglkelaesrg
Timeline for d2coha4: