SCOPe 2.07: Domain d2coha3: 2coh A:6-117

Lineage for d2coha3 (2coh A:6-117)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Transcriptional regulator TTHA1359, N-terminal domain [141641] (1 species)

7. Species Thermus thermophilus [TaxId:274] [141642] (2 PDB entries)
   Uniprot Q5SIL0 6-117

8. Domain d2coha3: 2coh A:6-117 [303691]
   Other proteins in same PDB: d2coha4
   automated match to d2zcwa2
   complexed with mpd

Details for d2coha3

PDB Entry: 2coh, 1.5 Å

PDB Description: Crystal Structure of Transcriptional Regulator TTHA1359 form Thermus thermophilus HB8

PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d2coha3:

Sequence; same for both SEQRES and ATOM records:

>d2coha3 b.82.3.2 (A:6-117) Transcriptional regulator TTHA1359, N-terminal domain {Thermus thermophilus [TaxId: 274]}
etvsfkagdvilypgvpgprdrayrvleglvrleavdeegnaltlrlvrpggffgeealf
gqeriyfaeaatdvrleplpenpdpellkdlaqhlsqglaeayrrierlatq

Timeline for d2coha3:

• d2coha3 first appeared in SCOPe 2.06
  
• d2coha3 appears in the current release, SCOPe 2.08