Lineage for d1el5a1 (1el5 A:1-217,A:322-385)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 688694Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 688695Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families) (S)
  5. 688749Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (15 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 688990Protein Sarcosine oxidase [51920] (1 species)
  7. 688991Species Bacillus sp., strain b0618 [TaxId:1409] [51921] (11 PDB entries)
  8. 688994Domain d1el5a1: 1el5 A:1-217,A:322-385 [30369]
    Other proteins in same PDB: d1el5a2, d1el5b2

Details for d1el5a1

PDB Entry: 1el5 (more details), 1.8 Å

PDB Description: complex of monomeric sarcosine oxidase with the inhibitor dimethylglycine
PDB Compounds: (A:) sarcosine oxidase

SCOP Domain Sequences for d1el5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1el5a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}
sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
dsvkietangsytadklivsmgawnskllsklnldipXdehfiidlhpehsnvviaagfs
ghgfkfssgvgevlsqlaltgktehdisifsinrpalkeslq

SCOP Domain Coordinates for d1el5a1:

Click to download the PDB-style file with coordinates for d1el5a1.
(The format of our PDB-style files is described here.)

Timeline for d1el5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1el5a2