![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
![]() | Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins) C-terminal domain is alpha+beta is common for the family |
![]() | Protein Sarcosine oxidase [51920] (1 species) |
![]() | Species Bacillus sp., strain b0618 [TaxId:1409] [51921] (17 PDB entries) |
![]() | Domain d1el5a1: 1el5 A:1-217,A:322-385 [30369] Other proteins in same PDB: d1el5a2, d1el5b2 complexed with cl, dmg, fad, po4 |
PDB Entry: 1el5 (more details), 1.8 Å
SCOPe Domain Sequences for d1el5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1el5a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp dsvkietangsytadklivsmgawnskllsklnldipXdehfiidlhpehsnvviaagfs ghgfkfssgvgevlsqlaltgktehdisifsinrpalkeslq
Timeline for d1el5a1: