Lineage for d2cn2b1 (2cn2 B:33-445)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066474Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families) (S)
    duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378)
  5. 2066488Family b.69.13.0: automated matches [227242] (1 protein)
    not a true family
  6. 2066489Protein automated matches [227008] (5 species)
    not a true protein
  7. 2066506Species Clostridium thermocellum [TaxId:1515] [311203] (2 PDB entries)
  8. 2066513Domain d2cn2b1: 2cn2 B:33-445 [303681]
    automated match to d5fkta1
    complexed with cd

Details for d2cn2b1

PDB Entry: 2cn2 (more details), 2.1 Å

PDB Description: crystal structures of clostridium thermocellum xyloglucanase
PDB Compounds: (B:) beta-1,4-xyloglucan hydrolase

SCOPe Domain Sequences for d2cn2b1:

Sequence, based on SEQRES records: (download)

>d2cn2b1 b.69.13.0 (B:33-445) automated matches {Clostridium thermocellum [TaxId: 1515]}
vtsvpykwdnvvigggggfmpgivfnetekdliyaradiggayrwdpstetwiplldhfq
mdeysyygvesiatdpvdpnrvyivagmytndwlpnmgailrstdrgetwektilpfkmg
gnmpgrsmgerlaidpndnrilylgtrcgnglwrstdygvtwskvesfpnpgtyiydpnf
dytkdiigvvwvvfdkssstpgnptktiyvgvadknesiyrstdggvtwkavpgqpkgll
phhgvlasngmlyitygdtcgpydgngkgqvwkfntrtgewiditpipysssdnrfcfag
lavdrqnpdiimvtsmnawwpdeyifrstdggatwkniwewgmyperilhyeidisaapw
ldwgtekqlpeinpklgwmigdieidpfnsdrmmyvtgatiygcdnltdwdrg

Sequence, based on observed residues (ATOM records): (download)

>d2cn2b1 b.69.13.0 (B:33-445) automated matches {Clostridium thermocellum [TaxId: 1515]}
vtsvpykwdnvvigggggfmpgivfnetekdliyaradiggayrwdpstetwiplldhfq
mdeysyygvesiatdpvdpnrvyivagmytndwlpnmgailrstdrgetwektilpfkmg
gnmpgrsmgerlaidpndnrilylgtrcgnglwrstdygvtwskvesfpnpgtiigvvwv
vfdkssstpgnptktiyvgvadknesiyrstdggvtwkavpgqpkgllphhgvlasngml
yitygdgkgqvwkfntrtgewiditpipysssdnrfcfaglavdrqnpdiimvtsmnaww
pdeyifrstdggatwkniwewgmyperilhyeidisaapwldwgtekqlpeinpklgwmi
gdieidpfnsdrmmyvtgatiygcdnltdwdrg

SCOPe Domain Coordinates for d2cn2b1:

Click to download the PDB-style file with coordinates for d2cn2b1.
(The format of our PDB-style files is described here.)

Timeline for d2cn2b1:

  • d2cn2b1 is new in SCOPe 2.06-stable