![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.78: F112-like [158320] (1 protein) |
![]() | Protein F-112 [158321] (1 species) |
![]() | Species Sulfolobus virus-like particle SSV1 [TaxId:244589] [158322] (2 PDB entries) Uniprot P20220 4-73 |
![]() | Domain d2cmxa_: 2cmx A: [303678] automated match to d2vqca1 |
PDB Entry: 2cmx (more details), 2.3 Å
SCOPe Domain Sequences for d2cmxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cmxa_ a.4.5.78 (A:) F-112 {Sulfolobus virus-like particle SSV1 [TaxId: 244589]} tlnsykmaeimykilekkgeltledilaqfeisvpsayniqralkaicerhpdecevqyk nrkttfkwik
Timeline for d2cmxa_: