Lineage for d2cmxa_ (2cmx A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694460Family a.4.5.78: F112-like [158320] (1 protein)
  6. 2694461Protein F-112 [158321] (1 species)
  7. 2694462Species Sulfolobus virus-like particle SSV1 [TaxId:244589] [158322] (2 PDB entries)
    Uniprot P20220 4-73
  8. 2694463Domain d2cmxa_: 2cmx A: [303678]
    automated match to d2vqca1

Details for d2cmxa_

PDB Entry: 2cmx (more details), 2.3 Å

PDB Description: structure of a dna binding winged-helix protein, f-112, from sulfolobus spindle-shaped virus 1.
PDB Compounds: (A:) hypothetical 13.2 kda protein

SCOPe Domain Sequences for d2cmxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cmxa_ a.4.5.78 (A:) F-112 {Sulfolobus virus-like particle SSV1 [TaxId: 244589]}
tlnsykmaeimykilekkgeltledilaqfeisvpsayniqralkaicerhpdecevqyk
nrkttfkwik

SCOPe Domain Coordinates for d2cmxa_:

Click to download the PDB-style file with coordinates for d2cmxa_.
(The format of our PDB-style files is described here.)

Timeline for d2cmxa_: