Lineage for d2cmqb_ (2cmq B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016066Fold a.250: IpaD-like [140692] (1 superfamily)
    6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest
  4. 2016067Superfamily a.250.1: IpaD-like [140693] (2 families) (S)
  5. 2016068Family a.250.1.1: IpaD-like [140694] (3 protein domains)
    Pfam PF06511
  6. 2016075Protein Putative membrane antigen BipD [140697] (1 species)
  7. 2016076Species Burkholderia pseudomallei [TaxId:28450] [140698] (5 PDB entries)
    Uniprot Q63K37 35-301
  8. 2016082Domain d2cmqb_: 2cmq B: [303677]
    automated match to d2j9ta1
    complexed with flc, imd

Details for d2cmqb_

PDB Entry: 2cmq (more details), 2.7 Å

PDB Description: bipd of burkholderia pseudomallei
PDB Compounds: (B:) putative membrane antigen

SCOPe Domain Sequences for d2cmqb_:

Sequence, based on SEQRES records: (download)

>d2cmqb_ a.250.1.1 (B:) Putative membrane antigen BipD {Burkholderia pseudomallei [TaxId: 28450]}
mtdddlraagvdrrvpeqklgaaidefaslrlpdridgrfvdgrranltvfddarvavrg
haraqrnllerletellggtldtagdeggiqpdpilqglvdvigqgksdidayativegl
tkyfqsvadvmsklqdyisakddknmkidggkikaliqqvidhlptmqlpkgadiarwrk
elgdavsisdsgvvtinpdklikmrdslppdgtvwdtaryqawntafsgqkdniqndvqt
lvekyshqnsnfdnlvkvlsgaistlt

Sequence, based on observed residues (ATOM records): (download)

>d2cmqb_ a.250.1.1 (B:) Putative membrane antigen BipD {Burkholderia pseudomallei [TaxId: 28450]}
mtdddlraagvdrrvpeqklgaaidefaslrlpdridgrfvdgrranltvfddarvavrg
haraqrnllerletelldpilqglvdvigqgksdidayativegltkyfqsvadvmsklq
dyisakddknmkidggkikaliqqvidhlptmqlpkgadiarwrkelgdavsisdsgvvt
inpdklikmrdslppdgtvwdtaryqawntafsgqkdniqndvqtlvekyshqnsnfdnl
vkvlsgaistlt

SCOPe Domain Coordinates for d2cmqb_:

Click to download the PDB-style file with coordinates for d2cmqb_.
(The format of our PDB-style files is described here.)

Timeline for d2cmqb_:

  • d2cmqb_ is new in SCOPe 2.06-stable