Lineage for d2cjvj_ (2cjv J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739974Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 2740041Domain d2cjvj_: 2cjv J: [303661]
    Other proteins in same PDB: d2cjvk_, d2cjvl_
    automated match to d2uudh1
    complexed with phx

Details for d2cjvj_

PDB Entry: 2cjv (more details), 2.9 Å

PDB Description: crystal structure of the tepc15-vk45.1 anti-2-phenyl-5-oxazolone nq10-1.12 scfv in complex with phoxgaba
PDB Compounds: (J:) nq10-1.12 anti-phox antibody

SCOPe Domain Sequences for d2cjvj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cjvj_ b.1.1.1 (J:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklvesggglvqpggslrlscatsgfsftdyymawvrqppgkalewlafirnkangytt
dysasvkgrftisrdnsqsilylqmntlraedsatyycargsyygawfaywgqgtlvtvs
a

SCOPe Domain Coordinates for d2cjvj_:

Click to download the PDB-style file with coordinates for d2cjvj_.
(The format of our PDB-style files is described here.)

Timeline for d2cjvj_: