SCOPe 2.08: Domain d2cgga_: 2cgg A:

Lineage for d2cgga_ (2cgg A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species Human sars coronavirus [TaxId:227859] [187234] (2 PDB entries)

8. Domain d2cgga_: 2cgg A: [303658]
   automated match to d2gt7a_
   complexed with bez, dms

Details for d2cgga_

PDB Entry: 2cgg, 2.17 Å

PDB Description: crystal structure of acylated sars coronavirus main proteinase

PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d2cgga_:

Sequence; same for both SEQRES and ATOM records:

>d2cgga_ b.47.1.4 (A:) automated matches {Human sars coronavirus [TaxId: 227859]}
gfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirk
snhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngs
psgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkf
ygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyep
ltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqcs

Timeline for d2cgga_:

• d2cgga_ first appeared in SCOPe 2.06
  
• d2cgga_ appears in SCOPe 2.07