SCOPe 2.06: Domain d2c61a2: 2c61 A:351-457

Lineage for d2c61a2 (2c61 A:351-457)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (11 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:192952] [311201] (4 PDB entries)

8. Domain d2c61a2: 2c61 A:351-457 [303653]
   Other proteins in same PDB: d2c61a1
   automated match to d3j9tb3

Details for d2c61a2

PDB Entry: 2c61, 1.5 Å

PDB Description: crystal structure of the non-catalytic b subunit of a-type atpase from m. mazei go1

PDB Compounds: (A:) a-type ATP synthase non-catalytic subunit b

SCOPe Domain Sequences for d2c61a2:

Sequence; same for both SEQRES and ATOM records:

>d2c61a2 a.69.1.0 (A:351-457) automated matches {Methanosarcina mazei [TaxId: 192952]}
mnsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdtkflefadlfedk
fvrqgrnenrtiedtleigwqilthlpenqlgridnkyiqkyhpahr

Timeline for d2c61a2:

• d2c61a2 is new in SCOPe 2.06-stable
  
• d2c61a2 appears in SCOPe 2.07
  
• d2c61a2 appears in the current release, SCOPe 2.08