![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
![]() | Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
![]() | Protein automated matches [254528] (17 species) not a true protein |
![]() | Species Methanosarcina mazei [TaxId:192952] [311201] (4 PDB entries) |
![]() | Domain d2c61a2: 2c61 A:351-457 [303653] Other proteins in same PDB: d2c61a1 automated match to d3j9tb3 |
PDB Entry: 2c61 (more details), 1.5 Å
SCOPe Domain Sequences for d2c61a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c61a2 a.69.1.0 (A:351-457) automated matches {Methanosarcina mazei [TaxId: 192952]} mnsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdtkflefadlfedk fvrqgrnenrtiedtleigwqilthlpenqlgridnkyiqkyhpahr
Timeline for d2c61a2: