SCOPe 2.08: Domain d2c61a1: 2c61 A:76-350

Lineage for d2c61a1 (2c61 A:76-350)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:192952] [311200] (4 PDB entries)

8. Domain d2c61a1: 2c61 A:76-350 [303652]
   Other proteins in same PDB: d2c61a2
   automated match to d3j9tb2

Details for d2c61a1

PDB Entry: 2c61, 1.5 Å

PDB Description: crystal structure of the non-catalytic b subunit of a-type atpase from m. mazei go1

PDB Compounds: (A:) a-type ATP synthase non-catalytic subunit b

SCOPe Domain Sequences for d2c61a1:

Sequence; same for both SEQRES and ATOM records:

>d2c61a1 c.37.1.0 (A:76-350) automated matches {Methanosarcina mazei [TaxId: 192952]}
lklpasvdllgrilsgsgeprdggprivpdqlldingaamnpyarlppkdfiqtgistid
gtntlvrgqklpifsasglphneialqiarqasvpgsesafavvfaamgitneeaqyfms
dfektgaleravvflnladdpaverivtprmaltaaeylayehgmhvlviltditnyaea
lrqmgaarnevpgrrgypgymytdlatlyeragivkgakgsvtqipilsmpgddithpip
dlsgyitegqivvarelhrkgiyppinvlpslsrl

Timeline for d2c61a1:

• d2c61a1 first appeared in SCOPe 2.06
  
• d2c61a1 appears in SCOPe 2.07