Lineage for d1doea1 (1doe A:1-173,A:276-394)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 822279Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 822280Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 822334Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 822505Protein p-Hydroxybenzoate hydroxylase, PHBH [51917] (2 species)
  7. 822506Species Pseudomonas aeruginosa [TaxId:287] [51919] (18 PDB entries)
  8. 822520Domain d1doea1: 1doe A:1-173,A:276-394 [30365]
    Other proteins in same PDB: d1doea2
    complexed with br, dob, fad

Details for d1doea1

PDB Entry: 1doe (more details), 2.3 Å

PDB Description: the mobil flavin of 4-oh benzoate hydroxylase: motion of a prosthetic group regulates catalysis
PDB Compounds: (A:) p-hydroxybenzoate hydroxylase

SCOP Domain Sequences for d1doea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1doea1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]}
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrl
flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer
fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpyeeie

SCOP Domain Coordinates for d1doea1:

Click to download the PDB-style file with coordinates for d1doea1.
(The format of our PDB-style files is described here.)

Timeline for d1doea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1doea2