Lineage for d1d7la1 (1d7l A:1-173,A:276-394)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20809Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (7 proteins)
  6. 20840Protein p-Hydroxybenzoate hydroxylase (PHBH) [51917] (2 species)
  7. 20841Species Pseudomonas aeruginosa [TaxId:287] [51919] (14 PDB entries)
  8. 20849Domain d1d7la1: 1d7l A:1-173,A:276-394 [30364]
    Other proteins in same PDB: d1d7la2

Details for d1d7la1

PDB Entry: 1d7l (more details), 2.2 Å

PDB Description: structure-function correlations of the reaction of reduced nicotinamide analogs with p-hydroxybenzoate hydroxylase substituted with a series of 8-substituted flavins

SCOP Domain Sequences for d1d7la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7la1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas aeruginosa}
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrl
flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer
fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpyeeie

SCOP Domain Coordinates for d1d7la1:

Click to download the PDB-style file with coordinates for d1d7la1.
(The format of our PDB-style files is described here.)

Timeline for d1d7la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d7la2