SCOPe 2.08: Domain d2bzpb_: 2bzp B:

Lineage for d2bzpb_ (2bzp B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (6 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein Sentrin-specific protease 1 [142862] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142863] (8 PDB entries)
   Uniprot Q9P0U3 419-643

8. Domain d2bzpb_: 2bzp B: [303631]
   automated match to d2ckga_

Details for d2bzpb_

PDB Entry: 2bzp, 2.45 Å

PDB Description: senp1 structure

PDB Compounds: (B:) sentrin-specific protease 1

SCOPe Domain Sequences for d2bzpb_:

Sequence; same for both SEQRES and ATOM records:

>d2bzpb_ d.3.1.7 (B:) Sentrin-specific protease 1 {Human (Homo sapiens) [TaxId: 9606]}
efpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnml
merskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwclav
vdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqipqqmn
gsddcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll

Timeline for d2bzpb_:

• d2bzpb_ first appeared in SCOPe 2.06
  
• d2bzpb_ appears in SCOPe 2.07