Lineage for d1iusa1 (1ius A:1-173,A:276-394)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849379Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2849608Protein p-Hydroxybenzoate hydroxylase, PHBH [51917] (2 species)
  7. 2849609Species Pseudomonas aeruginosa [TaxId:287] [51919] (18 PDB entries)
  8. 2849623Domain d1iusa1: 1ius A:1-173,A:276-394 [30363]
    Other proteins in same PDB: d1iusa2
    complexed with fad, pab

Details for d1iusa1

PDB Entry: 1ius (more details), 2.2 Å

PDB Description: p-hydroxybenzoate hydroxylase complexed with 4-aminobenzoate at ph 5.0
PDB Compounds: (A:) p-hydroxybenzoate hydroxylase

SCOPe Domain Sequences for d1iusa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iusa1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]}
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrl
flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer
fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpyeeie

SCOPe Domain Coordinates for d1iusa1:

Click to download the PDB-style file with coordinates for d1iusa1.
(The format of our PDB-style files is described here.)

Timeline for d1iusa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iusa2