Lineage for d2bw6a_ (2bw6 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2066547Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2066606Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
    contains an extra alpha-helical domain
  7. 2066612Species Human coronavirus [TaxId:443239] [188597] (3 PDB entries)
  8. 2066615Domain d2bw6a_: 2bw6 A: [303625]
    automated match to d1uj1b_

Details for d2bw6a_

PDB Entry: 2bw6 (more details), 1.9 Å

PDB Description: the structure of sars 3c like protease at 1.9a
PDB Compounds: (A:) papain-like proteinase

SCOPe Domain Sequences for d2bw6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bw6a_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Human coronavirus [TaxId: 443239]}
gfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirk
snhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngs
psgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkf
ygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyep
ltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqcs
g

SCOPe Domain Coordinates for d2bw6a_:

Click to download the PDB-style file with coordinates for d2bw6a_.
(The format of our PDB-style files is described here.)

Timeline for d2bw6a_: