Lineage for d2bsva4 (2bsv A:182-276)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2349424Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2349425Species Human (Homo sapiens) [TaxId:9606] [88605] (199 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 2349484Domain d2bsva4: 2bsv A:182-276 [303624]
    Other proteins in same PDB: d2bsva3
    automated match to d1ogaa1

Details for d2bsva4

PDB Entry: 2bsv (more details), 1.6 Å

PDB Description: t cell cross-reactivity and conformational changes during tcr engagement
PDB Compounds: (A:) hla class I histocompatibility antigen

SCOPe Domain Sequences for d2bsva4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bsva4 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwep

SCOPe Domain Coordinates for d2bsva4:

Click to download the PDB-style file with coordinates for d2bsva4.
(The format of our PDB-style files is described here.)

Timeline for d2bsva4: