SCOPe 2.08: Domain d2bsud3: 2bsu D:1-181

Lineage for d2bsud3 (2bsu D:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
   Uniprot P01892 25-298

8. Domain d2bsud3: 2bsu D:1-181 [303619]
   Other proteins in same PDB: d2bsua4, d2bsub2, d2bsub3, d2bsud4, d2bsue2, d2bsue3
   automated match to d1ogaa2

Details for d2bsud3

PDB Entry: 2bsu, 1.6 Å

PDB Description: t cell cross-reactivity and conformational changes during tcr engagement

PDB Compounds: (D:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d2bsud3:

Sequence; same for both SEQRES and ATOM records:

>d2bsud3 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d2bsud3:

• d2bsud3 first appeared in SCOPe 2.06
  
• d2bsud3 appears in SCOPe 2.07