SCOPe 2.06: Domain d2bsna_: 2bsn A:

Lineage for d2bsna_ (2bsn A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.151: CobE/GbiG C-terminal domain-like [159663] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32154; strand 5 is antiparallel to the rest

4. Superfamily c.151.1: CobE/GbiG C-terminal domain-like [159664] (1 family)
   probably involved in deacylation steps in both anaerobic and aerobic pathways of cobalamin biosynthesis
   automatically mapped to Pfam PF01890

5. Family c.151.1.1: CobE/GbiG C-terminal domain-like [159665] (3 proteins)
   C-terminal part of Pfam PF01890 (CbiG); corresponds to standalone protein CobE in the aerobic pathway; also includes resent structure 3BY5

6. Protein Cobalamin biosynthesis protein CobE [159666] (2 species)
   predicted to facilitate the deacylation of precorrin-5 intermediate; this step can proceed non-enzymatically in vitro

7. Species Pseudomonas aeruginosa [TaxId:287] [159668] (2 PDB entries)
   Uniprot Q9HZQ0 1-139

8. Domain d2bsna_: 2bsn A: [303614]
   automated match to d2w6ka1
   complexed with gol, so4

Details for d2bsna_

PDB Entry: 2bsn, 1.8 Å

PDB Description: structure analysis of cobe, an essential protein of cobalamin biosynthesis from pseudomonas aeruginosa

PDB Compounds: (A:) hypothetical protein involved in cobalamin biosynthesis

SCOPe Domain Sequences for d2bsna_:

Sequence; same for both SEQRES and ATOM records:

>d2bsna_ c.151.1.1 (A:) Cobalamin biosynthesis protein CobE {Pseudomonas aeruginosa [TaxId: 287]}
gshmplpipslliagigcrrgcsaehlrallertlgehgrslaeldalasidgkrdepgl
rqlatllerpvhflapavlhdyeprllspsavalretgcssvaeaaalalaerlgggrad
llgakrsddrasialarllter

Timeline for d2bsna_:

• d2bsna_ is new in SCOPe 2.06-stable
  
• d2bsna_ appears in SCOPe 2.07
  
• d2bsna_ appears in the current release, SCOPe 2.08