Lineage for d2bq9c3 (2bq9 C:506-647)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775317Species Micromonospora viridifaciens [TaxId:1881] [254943] (4 PDB entries)
  8. 2775321Domain d2bq9c3: 2bq9 C:506-647 [303613]
    Other proteins in same PDB: d2bq9a1, d2bq9a2, d2bq9b1, d2bq9b2, d2bq9c1, d2bq9c2
    automated match to d1w8oa2
    complexed with gal, gol, na

Details for d2bq9c3

PDB Entry: 2bq9 (more details), 2 Å

PDB Description: galactose recognition by the carbohydrate-binding module of a bacterial sialidase
PDB Compounds: (C:) bacterial sialidase

SCOPe Domain Sequences for d2bq9c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bq9c3 b.18.1.0 (C:506-647) automated matches {Micromonospora viridifaciens [TaxId: 1881]}
qarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphrisldlggthtis
glqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqravfpardaryirlv
alseqtghkyaavaelevegqr

SCOPe Domain Coordinates for d2bq9c3:

Click to download the PDB-style file with coordinates for d2bq9c3.
(The format of our PDB-style files is described here.)

Timeline for d2bq9c3: