Lineage for d2bq9b1 (2bq9 B:47-402)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065266Protein automated matches [193245] (14 species)
    not a true protein
  7. 2065351Species Micromonospora viridifaciens [TaxId:1881] [254941] (4 PDB entries)
  8. 2065354Domain d2bq9b1: 2bq9 B:47-402 [303608]
    Other proteins in same PDB: d2bq9a2, d2bq9a3, d2bq9b2, d2bq9b3, d2bq9c2, d2bq9c3
    automated match to d1euta3
    complexed with gal, gol, na

Details for d2bq9b1

PDB Entry: 2bq9 (more details), 2 Å

PDB Description: galactose recognition by the carbohydrate-binding module of a bacterial sialidase
PDB Compounds: (B:) bacterial sialidase

SCOPe Domain Sequences for d2bq9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bq9b1 b.68.1.1 (B:47-402) automated matches {Micromonospora viridifaciens [TaxId: 1881]}
geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
iinaagafqavsvysddhgrtwrageavgvgmdanktvelsdgrvllnsrdsarsgyrkv
avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
irmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlg

SCOPe Domain Coordinates for d2bq9b1:

Click to download the PDB-style file with coordinates for d2bq9b1.
(The format of our PDB-style files is described here.)

Timeline for d2bq9b1:

  • d2bq9b1 is new in SCOPe 2.06-stable