Lineage for d2bpjb2 (2bpj B:241-608)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2515496Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2515497Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2515498Family c.80.1.1: double-SIS domain [53698] (5 proteins)
    duplication: consists of two SIS domains related by pseudo dyad
  6. 2515530Protein automated matches [227069] (2 species)
    not a true protein
  7. 2515531Species Escherichia coli [TaxId:562] [233109] (5 PDB entries)
  8. 2515543Domain d2bpjb2: 2bpj B:241-608 [303598]
    Other proteins in same PDB: d2bpja1, d2bpjb1
    automated match to d4amva1
    complexed with g6q, onl

Details for d2bpjb2

PDB Entry: 2bpj (more details), 2.35 Å

PDB Description: e coli glucosamine-6p synthase in complex with glucose-6p and 5-oxo-l-norleucine
PDB Compounds: (B:) glucosamine-fructose-6-phosphate aminotransferase

SCOPe Domain Sequences for d2bpjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bpjb2 c.80.1.1 (B:241-608) automated matches {Escherichia coli [TaxId: 562]}
dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac
gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr
lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls
rlkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial
egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg
gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn
laksvtve

SCOPe Domain Coordinates for d2bpjb2:

Click to download the PDB-style file with coordinates for d2bpjb2.
(The format of our PDB-style files is described here.)

Timeline for d2bpjb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bpjb1